PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G1028
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 162aa    MW: 18282.2 Da    PI: 10.1373
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G1028genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.4e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd llv +v+++G+g+W++++   g+ R+ k+c++rw +yl
      Gh_D13G1028 14 KGPWTPEEDILLVSYVQEHGPGNWRLVPTNTGLQRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding47.54e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Gh_D13G1028  67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDVKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.424965IPR017930Myb domain
SuperFamilySSF466894.79E-3211108IPR009057Homeodomain-like
SMARTSM007172.6E-141363IPR001005SANT/Myb domain
PfamPF002491.8E-171461IPR001005SANT/Myb domain
CDDcd001672.10E-121661No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129418.65266116IPR017930Myb domain
SMARTSM007173.2E-1366114IPR001005SANT/Myb domain
PfamPF002491.7E-1367112IPR001005SANT/Myb domain
CDDcd001675.93E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MGRSPCCDKV GIKKGPWTPE EDILLVSYVQ EHGPGNWRLV PTNTGLQRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDVKNYWNT HLKKKLKKFQ  120
PAMELPQMAQ ACLNKTLATG SSSTIATYAS STEIFLVFFK VG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-26141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461145.11e-112PREDICTED: myb-related protein 306-like
SwissprotP813923e-80MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B0NRD81e-113A0A0B0NRD8_G
STRINGPOPTR_0013s06390.17e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-83myb domain protein 60